PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004492666.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28423.2 Da    PI: 9.3071
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004492666.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.91.8e-30958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krienk+nrqvtfskRrng+lKKA+ELSvLCdae+a+iifss+gkl e+ 
  XP_004492666.1  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLSEFG 58
                    79**********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.2E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.576161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-33292IPR002100Transcription factor, MADS-box
CDDcd002653.38E-41275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.0E-2984172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.78788178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048437Biological Processfloral organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEIALIIFSS RGKLSEFGSS  60
TSGIAKTLER YQRCSFTSQN DNINENETQN WYQEMSKLKA KYESLQKSQR QLLGEDLGPL  120
NMKELQSLEK QLEGALAQAR QRKSQIMIEQ MEELRRKERH LGDINKQLRF KLESEGFNLK  180
AIENMWSSNS ATVSGGSSFP YQPSETNPMD CQAEPFLQIG YHQYVQAEPS NAPKSMVGET  240
SFIHGWIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-219317222101Developmental protein SEPALLATA 3
4ox0_B3e-219317222101Developmental protein SEPALLATA 3
4ox0_C3e-219317222101Developmental protein SEPALLATA 3
4ox0_D3e-219317222101Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004492666.10.0PREDICTED: agamous-like MADS-box protein AGL6
SwissprotP293861e-113AGL6_ARATH; Agamous-like MADS-box protein AGL6
TrEMBLG7L1F41e-165G7L1F4_MEDTR; MADS-box transcription factor
STRINGGLYMA07G08890.11e-135(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-109AGAMOUS-like 6